PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr008043.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family NAC
Protein Properties Length: 396aa    MW: 44651.5 Da    PI: 7.3418
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr008043.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.31.5e-5391381129
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                  +ppGfrFhPtdeel+++yLkkkv+ +k+++ evi+evd++k+ePwdL++  ++ +  ++ewyfFs++d+ky+tg+r+nratk+g+Wkatg+dk + + 
  Pbr008043.1   9 VPPGFRFHPTDEELLHYYLKKKVSFQKFDM-EVIREVDLNKMEPWDLQErcRIGStPQNEWYFFSHKDRKYPTGSRTNRATKAGFWKATGRDKCIRN- 104
                  69****************************.99**************963433332556*************************************9. PP

          NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrle 129
                  + +++g++ktLvfy+grap+g+ktdW+mheyrle
  Pbr008043.1 105 TFKQIGMRKTLVFYRGRAPHGQKTDWIMHEYRLE 138
                  8999****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-597161IPR003441NAC domain
PROSITE profilePS5100557.9649161IPR003441NAC domain
PfamPF023655.0E-2810137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 396 aa     Download sequence    Send to blast
MANSSSGGVP PGFRFHPTDE ELLHYYLKKK VSFQKFDMEV IREVDLNKME PWDLQERCRI  60
GSTPQNEWYF FSHKDRKYPT GSRTNRATKA GFWKATGRDK CIRNTFKQIG MRKTLVFYRG  120
RAPHGQKTDW IMHEYRLEDS DDPHGNLSSE DGWVICRVFK KKNLFKVANE GGSSSMNSSD  180
HQQLKNTSTN SQLQARSFMH SHGDNQYLLR QQLHAATQAF ELNNNPSLHY AHLQPPPHYS  240
PFQSQALIPT FAHKPLSACD DYSSQLPSDD SPSHGMVKQL MTNPRDCESG SEGLRYQACE  300
PVLEVGTCEP NHQLNTVAGG AGAAGGRDNN HDHQGMSEWA MLDRLVTSHD LGNDQDSSSK  360
GAARYEDANA PSSVNQINPQ HLSLRGEMDF WGYAK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-51916317167NO APICAL MERISTEM PROTEIN
1ut4_B2e-51916317167NO APICAL MERISTEM PROTEIN
1ut7_A2e-51916317167NO APICAL MERISTEM PROTEIN
1ut7_B2e-51916317167NO APICAL MERISTEM PROTEIN
3swm_A3e-51916320170NAC domain-containing protein 19
3swm_B3e-51916320170NAC domain-containing protein 19
3swm_C3e-51916320170NAC domain-containing protein 19
3swm_D3e-51916320170NAC domain-containing protein 19
3swp_A3e-51916320170NAC domain-containing protein 19
3swp_B3e-51916320170NAC domain-containing protein 19
3swp_C3e-51916320170NAC domain-containing protein 19
3swp_D3e-51916320170NAC domain-containing protein 19
3ulx_A3e-51916315170Stress-induced transcription factor NAC1
4dul_A2e-51916317167NAC domain-containing protein 19
4dul_B2e-51916317167NAC domain-containing protein 19
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2103829e-41AC210382.1 Populus trichocarpa clone POP018-P22, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009366882.10.0PREDICTED: protein BEARSKIN1
SwissprotQ9SV871e-152BRN2_ARATH; Protein BEARSKIN2
TrEMBLM5VLK30.0M5VLK3_PRUPE; Uncharacterized protein
STRINGPOPTR_0019s09400.11e-170(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF87523343
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G10350.11e-152NAC domain containing protein 70